PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g02820.1
Common NameLR48_Vigan10g045200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 504aa    MW: 54780 Da    PI: 5.4071
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g02820.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-1783127147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+eE++++++a k++G g W+ I +++g ++t+ q++s+ qk+
   Vang02g02820.1  83 REKWTEEEHQKFLEALKLYGRG-WRQIEEHIG-TKTAVQIRSHAQKF 127
                      789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.26E-1677131IPR009057Homeodomain-like
PROSITE profilePS5129421.20178132IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-1080134IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-1681130IPR006447Myb domain, plants
SMARTSM007174.5E-1382130IPR001005SANT/Myb domain
PfamPF002491.3E-1483126IPR001005SANT/Myb domain
CDDcd001672.99E-1185128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
LSLLAAGVSL CGGLGCFPRQ ADSHFAPMEM QDQIENTRST ISGSASNCHS NAGKQSENVA  60
HIPSVRNGHA PKVRKPYTIT KQREKWTEEE HQKFLEALKL YGRGWRQIEE HIGTKTAVQI  120
RSHAQKFFSK VVRESEGSAE SSIQPINIPP PRPKRKPLHP YPRKSVDAFR GHAIPNETET  180
SQSTNLLVAE KDTPSPTSVL STVGSEAFGS AFSEQNNRCL SPNSCTTDIH SVSLSPVEKE  240
NDCMTSKASE EEEKGSPASV PLSIVSDPNM CMKPEFSSKE TEYGIDDSAN MPQTTSIKLF  300
GRTVSMVDNQ KPQNIDDNGK AIITVKSDVV DDAGNEKLGQ STEQVDTQLS LGLVGGNCSI  360
TPDSDGADRS EEPPKENVCL SECVPDASFP QWSLYQGLPA FCVSPCNQIL NHMPLRPSLK  420
VRAREEESCC TGSNTESVCD MENQGKNSDA VDSKCEKYEG EGAAPQKPAR GFVPYKRCLA  480
ERDGTSLIAA LEERDGQRAR VCS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511774.10.0PREDICTED: protein REVEILLE 7-like
RefseqXP_014511780.10.0PREDICTED: protein REVEILLE 7-like
RefseqXP_014511786.10.0PREDICTED: protein REVEILLE 7-like
TrEMBLA0A0L9VHM40.0A0A0L9VHM4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3TC580.0A0A0S3TC58_PHAAN; Uncharacterized protein
STRINGGLYMA16G34340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.21e-52MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]